other species
Home About Expansins... Protein Structure Expansin Genes abstracts Nomenclature


This page has tables of expansin names, sequences and links for rice, poplar and other species.

bulletTable of accepted rice gene symbols (names) and links to sequences  
bulletRice expansin genes ordered by genomic location
bulletProtein sequence listing for all rice expansins (FASTA format)
bulletProtein sequences for all expansins in poplar (FASTA format)
bulletProtein sequences for some expansins in papaya (FASTA format)
bulletListing of miscellaneous EXPA (a-expansin) sequences from other species
bulletListing of miscellaneous EXPB (b-expansin) sequences from other species

horizontal rule

Names and hotlinks to genomic loci for rice expansins, with correspondence to old symbols. 
Link to page with sequence details.
Locus converter between MSU and RAP designations can be found here.

New Symbol

old symbols

Chr # Locus (MSU) Locus (RAP-DB) Swiss-Prot Comments
EXPA1 OsEXP1 osaEXPa1.16 4 LOC_Os04g15840 Os04g0228400 Q7XWU8  
EXPA2 OsEXP2 osaEXPa1.23 1 LOC_Os01g60770 Os01g0823100 Q40636  
EXPA3 OsEXP3 osaEXPa1.18 5 LOC_Os05g19570 Os05g0276500 Q40637  
EXPA4 OsEXP4 osaEXPa1.22 5 LOC_Os05g39990 Os05g0477600 Q0DHB7  
EXPA5 OsEXP5 osaEXPa1.20 2 LOC_Os02g51040 Os02g0744200 Q6ZGU9  
EXPA6 OsEXP6 osaEXPa1.24 3 LOC_Os03g21820 Os03g0336400 Q9M4X7  
EXPA7 OsEXP7 osaEXPa1.26 3 LOC_Os03g60720 Os03g0822000 Q852A1  
EXPA8 OsEXP8 osaEXPa1.17 1 LOC_Os01g14650 Os01g0248900 Q9XHX0  
EXPA9 OsEXP9 osaEXPa1.19 1 LOC_Os01g14660 Os01g0249100 Q4PR53  
EXPA10 OsEXP10 osaEXPa1.28 4 LOC_Os04g49410 Os04g0583500 Q7XUD0  
EXPA11 OsEXP11 osaEXPa1.25 1 LOC_Os01g16770 Os01g0274500 Q4PNY1  
EXPA12 OsEXP12 osaEXPa1.15 3 LOC_Os03g06000 Os03g0155300 Q7G6Z2  
EXPA13 OsEXP13 osaEXPa1.13 2 LOC_Os02g16730 Os02g0267200 Q4PR52  
EXPA14 OsEXP14 osaEXPa1.11 2 LOC_Os02g16780 Os02g0267700 Q4PR51  
EXPA15 OsEXP15 osaEXPa1.8 3 LOC_Os03g06020 Os03g0155600 Q4PR50  
EXPA16 OsEXP16 osaEXPa1.27 6 LOC_Os06g41700 Os06g0621900 Q69XV9  
EXPA17 OsEXP17 osaEXPa1.31 6 LOC_Os06g01920 Os06g0108600 Q4PR49  
EXPA18 OsEXP18 osaEXPa1.3 3 LOC_Os03g06040 Os03g0155900 Q4PR48  
EXPA19 OsEXP19 osaEXPa1.2 3 LOC_Os03g06050 Os03g0156000 Q7G6Z5  
EXPA20 OsEXP20 osaEXPa1.1 3 LOC_Os03g06060 Os03g0156300 Q10RK1  
EXPA21 OsEXP21 osaEXPa1.21 3 LOC_Os03g25990 Os03g0377100 Q10KN4  
EXPA22 OsEXP22 osaEXPa1.9 2 LOC_Os02g16850 Os02g0268600 Q4PR44  
EXPA23 OsEXP23 osaEXPa1.12 2 LOC_Os02g16809
LOC_Os02g16839
Os02g0268050 Q4PR43  
EXPA24 OsEXP24 osaEXPa1.10 2 LOC_Os02g16800 Os02g0267900 Q4PR42  
EXPA25 OsEXP25 osaEXPa1.6 3 LOC_Os03g06010 Os03g0155500 Q4PR41  
EXPA26 OsEXP26 osaEXPa1.29 12 LOC_Os12g36040 Os12g0546800 Q2QP13  
EXPA27 OsEXP27 osaEXPa1.4 10 LOC_Os10g30330 Os10g0439100 Q7XE35  
EXPA28 OsEXP28 osaEXPa1.7 10 LOC_Os10g30340 Os10g0439200 Q4PR40  
EXPA29 OsEXP29 osaEXPa1.14 6 LOC_Os06g50400 Os06g0718100 Q4PR39  
EXPA30 OsEXP30 osaEXPa1.32 10 LOC_Os10g39110 Os10g0535900 Q8W2X8  
EXPA31 OsEXP31 osaEXPa1.5 3 LOC_Os03g31480 Os03g0428700 Q75I75  
EXPA32 OsEXP32 osaEXPa1.30 8 LOC_Os08g44790 Os08g0561900 Q6YYW5  
EXPA33 OsEXP33   5 LOC_Os05g19600 Os05g0277000 P0C1Y4  
               
EXPB1a EXPB1 osaEXPb1.2 3 LOC_Os03g01610 Os03g0106500 Q40638 Group-1 pollen allergen, class A*
EXPB1b EXPB1 osaEXPb1.3 3 LOC_Os03g01650 Os03g0106900 Q40638 Group-1 pollen allergen, class A*
EXPB2 EXPB2 osaEXPb1.9 10 LOC_Os10g40710 Os10g0555700 O24230  
EXPB3 EXPB3 osaEXPb1.10 10 LOC_Os10g40720 Os10g0555900    
EXPB4 EXPB4 osaEXPb1.7 10 LOC_Os10g40730 Os10g0556100 Q94LR4  
EXPB5 EXPB5 osaEXPb1.19 4 LOC_Os04g46650 Os04g0552200 Q7XT39  
EXPB6 EXPB6 osaEXPb1.8 10 LOC_Os10g40700 Os10g0555600 Q7XCA7  
EXPB7 EXPB7 osaEXPb1.12 3 LOC_Os03g01270 Os03g0102700 Q9LD07  
EXPB8 EXPB8 osaEXPb1.11 3 LOC_Os03g01260 Os03g0102500 Q10T32  
EXPB9 EXPB9 osaEXPb1.6 10 LOC_Os10g40090 Os10g0548600 Q7XCG7 Group-1 pollen allergen, class B*
EXPB10 EXPB10 osaEXPb1.5 3 LOC_Os03g01640 Os03g0106800 Q8H7T4 Group-1 pollen allergen, class A*
EXPB11 EXPB11 osaEXPb1.20 2 LOC_Os02g44108 Os02g0658800 Q6H676  
EXPB12 EXPB12 osaEXPb1.17 3 LOC_Os03g44290 Os03g0645000 Q10G40  
EXPB13 EXPB13 osaEXPb1.4p 3 LOC_Os03g01630 Os03g0106700 Q946J4 Group-1 pollen allergen, class A*
EXPB14 EXPB14 osaEXPb1.18 2 LOC_Os02g44106 Os02g0658600 Q6H677  
EXPB15 EXPB15 osaEXPb1.16 4 LOC_Os04g46630 Os04g0552000 Q7XT40  
EXPB16 EXPB16 osaEXPb1.14 2 LOC_Os02g42650 Os02g0639500 Q0DZ85  
EXPB17 EXPB17 osaEXPb1.13 4 LOC_Os04g44780 Os04g0530100 Q7X6J9  
EXPB18 EXPB18 osaEXPb1.15 5 LOC_Os05g15690 Os05g0246300 Q5W6Z9  
               
EXLA1 EXPL1 osaEXPb2.1 3 LOC_Os03g04020 Os03g0132200 Q10S70  
EXLA2 EXPL2 osaEXPb2.2 10 LOC_Os10g39640 Os10g0542400 Q7XCL0  
EXLA3 EXPL3 osaEXPb2.3 7 LOC_Os07g29290 Os07g0475400 Q8H274  
EXLA4 EXPL4   6 LOC_Os06g50960 Os06g0725300 Q5Z980  
               
EXLB1 OsEXPR1 osaEXPb3.1 7 LOC_Os07g31390 Os07g0496250 Q850K7  

*See Valdivia et al. 2007 Plant Physiology 143:1269 and refs cited therein for more information on group-1 allergens.

Rice expansin gene table ordered by genomic location. Tandem genes are colored in the same block

Name Chr # Locus (MSU) Locus (RAP-DB) Swiss-Prot comments
EXPA8 1 LOC_Os01g14650 Os01g0248900 Q9XHX0  
EXPA9 1 LOC_Os01g14660 Os01g0249100 Q4PR53  
EXPA11 1 LOC_Os01g16770 Os01g0274500 Q4PNY1  
EXPA2 1 LOC_Os01g60770 Os01g0823100  Q40636  
EXPA13 2 LOC_Os02g16730 Os02g0267200 Q4PR52  
EXPA14 2 LOC_Os02g16780 Os02g0267700 Q4PR51  
EXPA24 2 LOC_Os02g16800 Os02g0267900 Q4PR42  
EXPA23 2 LOC_Os02g16809 LOC_Os02g16839 Os02g0268050 Q4PR43 something funny w/TIGR-MSU annotation
EXPA22 2 LOC_Os02g16850 Os02g0268600 Q4PR44  
EXPB16 2 LOC_Os02g42650 Os02g0639500 Q0DZ85  
EXPB14 2 LOC_Os02g44106 Os02g0658600 Q6H677   
EXPB11 2 LOC_Os02g44108 Os02g0658800 Q6H676  
EXPA5 2 LOC_Os02g51040 Os02g0744200 Q6ZGU9  
EXPB8 3 LOC_Os03g01260 Os03g0102500 Q10T32  
EXPB7 3 LOC_Os03g01270 Os03g0102700 Q9LD07  
EXPB1a 3 LOC_Os03g01610 Os03g0106500 Q40638 Group-1 pollen allergen, class A
EXPB13 3 LOC_Os03g01630 Os03g0106700 Q946J4 Group-1 pollen allergen, class A (pseudogene? Premature stop codon)
EXPB10 3 LOC_Os03g01640 Os03g0106800 Q8H7T4 Group-1 pollen allergen, class A
EXPB1b 3 LOC_Os03g01650 Os03g0106900 Q40638 Group-1 pollen allergen, class A
EXLA1 3 LOC_Os03g04020 Os03g0132200 Q10S70  
EXPA12 3 LOC_Os03g06000 Os03g0155300 Q7G6Z2  
EXPA25 3 LOC_Os03g06010 Os03g0155500 Q4PR41  
EXPA15 3 LOC_Os03g06020 Os03g0155600 Q4PR50  
EXPA18 3 LOC_Os03g06040 Os03g0155900 Q4PR48  
EXPA19 3 LOC_Os03g06050 Os03g0156000 Q7G6Z5  
EXPA20 3 LOC_Os03g06060 Os03g0156300 Q10RK1  
EXPA6 3 LOC_Os03g21820 Os03g0336400 Q9M4X7  
EXPA21 3 LOC_Os03g25990 Os03g0377100 Q10KN4  
EXPA31 3 LOC_Os03g31480 Os03g0428700 Q75I75  
EXPB12 3 LOC_Os03g44290 Os03g0645000 Q10G40  
EXPA7 3 LOC_Os03g60720 Os03g0822000 Q852A1  
EXPA1 4 LOC_Os04g15840 Os04g0228400 Q7XWU8  
EXPB17 4 LOC_Os04g44780 Os04g0530100 Q7X6J9  
EXPB15 4 LOC_Os04g46630 Os04g0552000 Q7XT40  
EXPB5 4 LOC_Os04g46650 Os04g0552200 Q7XT39  
EXPA10 4 LOC_Os04g49410 Os04g0583500 Q7XUD0  
EXPB18 5 LOC_Os05g15690 Os05g0246300 Q5W6Z9  
EXPA3 5 LOC_Os05g19570 Os05g0276500 Q40637  
EXPA33 5 LOC_Os05g19600 Os05g0277000 P0C1Y4  
EXPA4 5 LOC_Os05g39990 Os05g0477600 Q0DHB7  
EXPA17 6 LOC_Os06g01920 Os06g0108600 Q4PR49  
EXPA16 6 LOC_Os06g41700 Os06g0621900 Q69XV9  
EXPA29 6 LOC_Os06g50400 Os06g0718100 Q4PR39  
EXLA4 6 LOC_Os06g50960 Os06g0725300 Q5Z980  
EXLA3 7 LOC_Os07g29290 Os07g0475400 Q8H274  
EXLB1 7 LOC_Os07g31390 Os07g0496250 Q850K7  
EXPA32 8 LOC_Os08g44790 Os08g0561900 Q6YYW5  
EXPA27 10 LOC_Os10g30330 Os10g0439100 Q7XE35  
EXPA28 10 LOC_Os10g30340 Os10g0439200 Q4PR40  
EXPA30 10 LOC_Os10g39110 Os10g0535900 Q8W2X8  
EXLA2 10 LOC_Os10g39640 Os10g0542400 Q7XCL0  
EXPB9 10 LOC_Os10g40090 Os10g0548600 Q7XCG7 Group-1 pollen allergen, class B
EXPB6 10 LOC_Os10g40700 Os10g0555600 Q7XCA7  
EXPB2 10 LOC_Os10g40710 Os10g0555700 O24230  
EXPB3 10 LOC_Os10g40720 Os10g0555900 Q336T5  
EXPB4 10 LOC_Os10g40730 Os10g0556100 Q94LR4  
EXPA26 12 LOC_Os12g36040 Os12g0546800 Q2QP13  

Protein sequences for all rice expansins (FASTA format)

>OsEXPA1
MAGSSAATSCARFLALLATCLLWNEAASFTASGWNKAFATFYGGSDASGT
MGGACGYGDLYSTGYGTNTAALSTVLFNDGASCGQCYRIMCDYQADRRFC
ISGTSVTITATNLCPPNYALPNDAGGWCNPPRQHFDMAEPAWLKIGVYVG
GIVPVMYQRVPCAKQGGVRFTINGRDYFELVLVSNVGGVGSIQSVSIKGS
RTGWMAMSRNWGVNWQSNAYLDGQSLSFKVTSSDGQTLTFLDVAPAGWTF
GQTFSTSQQFS*
>OsEXPA2
MASRSSALLLLFSAFCFLARRAAADYGSWQSAHATFYGGGDASGTMGGAC
GYGNLYSTGYGTNTAALSTVLFNDGAACGSCYELRCDNDGQWCLPGSVTV
TATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYR
RVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGDVQSVSIKGSSTGWQPMS
RNWGQNWQSNSYLDGQSLSFQVAVSDGRTVTSNNVVPAGWQFGQTFEGGQ
F*
>OsEXPA3
MLSGMEKQPAMLLVLVTLCAFACKXSVAQSAFATFYGGKDGSCTMGGACG
YGNLYNAGYGLYNAALSSALFNDGAMCGACYTITCDTSQTKWCKPGGNSI
TITATNLCPPNWALPSNSGGWCNPPLQHFDMSQPAWENIAVYQAGIVPVN
YKRVPCQRSGGIRFAISGHDYFELVTVTNVGGSGVVAQMSIKGSNTGWMA
MSRNWGANWQSNAYLAGQSLSFIVQLDDGRKVTAWNVAPSNWFFGATYST
SWVQF*
>OsEXPA4
MAIAGVLFLLFLARQASAAGYGGWQSAHATFYGGGDASGTMGGACGYGNL
YSQGYGTNTAALSTALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNF
CPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCV
KKGGVRFTVNGHSYFNLVLVTNVAGAGDVRSVSIKGSRTGWQPMSRNWGQ
NWQSNAFLDGQSLSFQVTASDGRTVTSNNVAHPGWQFGQTFEGGQF*
>OsEXPA5
MSSRRDVLAVVLVAALLPPALSRGLWLGHHGLGHGHGRWRAPHVGGHGQG
QGPQQHAPLGGGGWSSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTA
ALSTALFNNGLSCGACFEVRCDAGGGGSHSCLPGSVVVTATNFCPPNNAL
PSDDGGWCNPPRAHFDMSQPVFQRIALFKAGIVPVSYRRVACQKKGGIRF
TINGHSYFNLVLVTNVGGAGDVHAVAVKSERSAAWQALSRNWGQNWQSAA
LLDGQALSFRVTTGDGRSVVSNNAVPRGWSFGQTFSGAQFN*
>OsEXPA6
MAPPLLLLLASLLLVAARRALGLGLGQWQPGHATFYGGGDASGTMGGACG
YGNLYSQGYGTSTAALSTALFNRGLSCGSCYELRCAGDHRRSCLPGGATV
TVTATNFCPPNYALPSDGGGWCNPPRRHFDLAEPAFLRIARHAAGIVPVS
FRRVACARKGGVRFTVNGHAYFNLVLVTNVGGAGDVRSLAVXGSGSGSRV
GGRWQPMSRNWGQNWQSNAYLDGKALSFRVTAGDGRSLTCADVAPAGWQF
GQTFEGRQF*
>OsEXPA7
MSPAPRVLVLVVATVVALQVSPAAGRIPGAYGGGEWQSAHATFYGGSDAS
GTMGGACGYGNLYSQGYGVNNAALSTALFNSGQSCGACFEIKCVNQPGWE
WCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLHIAE
YRAGIVPVSYRRVPCRKKGGVRFTINGFRYFNLVLITNVAGAGDIVRASV
KGTSTGWMPMSRNWGQNWQSNSVLVGQALSFRVTGSDRRTSTSWNAAPAG
WHFGQTFEGKNFRV*
>OsEXPA8
MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGGACGYGD
LYGAGYGTRTAALSTALFNGGASCGACFTIACDTRKTQWCKPGTSITVTA
TNFCPPNYALSGDAGGWCNPPRRHFDMSQPAWETIAVYRAGIVPVNYRRV
PCQRSGGIRFAVNGHSYFELVLVTNVGGSGAVAQMWIKGSGTGWMAMSRN
WGANWQSNARLDGQALSFRVQADDGRVVTAADVAPAGWSFGATYTSSAQF
Y*
>OsEXPA9
MEKKLLVVLFLSLCCASRLRGEAAQQWTSATATFYGGSDASGTMGGSCGY
GNMYSAGYGTNTTALSSALYGDGASCGACYLVTCDASATRWCKNGTSVTV
TATNYCPPNYSESGDAGGWCNPPRRHFDMSQPAWEAIAVYSSGIVPVRYA
RTPCRRVGGIRFGIAGHDYYELVLVTNVAGSGAVAAAWVKGSGTEWLSMS
RNWGENWQSNAYLTGQALSFRVQADDGGVVTAYDVAPANWQFGSTYQSDV
NFSY*
>OsEXPA10
MAPCLLLVLFLLPALATGHQHPSTLGSSALSEWRSAKASYYAADPEDAIG
GACGFGDLGKHGYGMATVGLSTALFERGAACGGCYEVKCVDDLKYCLPGT
SIVVTATNFCAPNFGLPADAGGVCNPPNHHFLLPIQSFEKIALWKAGVMP
IQYRRVNCLRDGGVRFAVAGRSFFLTVLISNVGGAGDVRSVKIKGTESGW
LSMGRNWGQIWHINSDFRGQPLSFELTSSDGKTLTNYNVVPKEWDFGKTY
TGKQFLL*
>OsEXPA11
MELLRLLAVAAVAAMAAEVAAGGDSGWSSGSATFYGGSDASGTMGGACGY
GNLYSAGYGTSTAALSTALFNNGQSCGACFEVRCGGGGSCLAGTVAVTAT
NLCPPNYALAGDAGGWCNPPRPHFDMAEPAFTRIAQARAGVVPVQYRRVA
CAKQGGIRFTITGHSYFNLVLVTNVGGAGDVTAVSVKGSRSGWQAMSHNW
GANWQNGANLDGQPLSFRVTASDGRTVTSDNVAPSGWSFGQTFSGGQF*
>OsEXPA12
MARSAFFFHCVAAVAACIAATAAALSGTATFYGGSDASGTMGGACGYGNL
YSTGYGTNTAALSSALFNDGAACGECYQITCDQSNSKWCKAGTSVTITAT
NLCPPDYSKPSNDGGWCNPPRQHFDMAQPAWEQIGVYRGGIVPVNFQRVS
CTRKGGVRFTINGNSYFELVLITNVGGPGSIKSVQIKGTKTGWVTMSRNW
GANWQANNYLNNQAISFSVTSTAGKTLVFEDVAPSNWQFGQTFTSGVQFY*
>OsEXPA13
MAGVARMLAAVVCAIMPAAAMAAGGVGALEPSGWVRAHATFYGGADASGT
MGGACGYGNLYAQGYGTRTAALSTALFNDGLACGQCYKLVCDRKTDRTWC
KPGVSVTITATNFCPPNWDLPSDSGGWCNPPRPHFDMAQPAWEKIGIYRG
GIIPVIYQRVPCMKKGGVRFTINGHDYFQLVLLTNVGAAGSIKAMDVKGS
KSPDWMAMAHNWGAQWHSLAYLTGQGLSFRVTITDGQTLVFPNVVRPGWR
FGQTFASNIQFK*
>OsEXPA14
MASSPRAFALVFFAIAAVGCTQLTTADDAAPPVWQKAHATFYGGADASGT
MGGGCGYGDLYSQGYGTRNAALSTALFNDGASCGQCYKIACDRKRAPQWC
KPGVTVTITATNFCPPNWDLPSDNGGWCNPPRPHFDMAQPAWEKIGIYSA
GIIPVIYQRVPCIKKGGVRFTINGHDYFNLVLVTNVATTGSIKSMDIMGS
NSTDWMPMVRNWGANWHSLSYLTGQTLSFRVTNMDGQTLVFKNIVPSGWK
FGQTFTSKLQFK*
>OsEXPA15
MAMWKKKKTPSILPLVVVIAAASLIAPTTAGWSSGTATFYGGSDASGTMG
GACGYGNLYWSGYGTNTAALSSALFNDGASCGQCYQIACDHQAEPRWCLQ
GRTVTITGTNLCPPNYALSSNDGGWCNPPRTHFDMAEPAWLQIGIYKAGI
VPVLYQRVPCVKQGGVRFTMGGFNYFELVLISNVAGSGSIQSVWVKGPNT
DRMPLSRNWGANWQSHAGLVGQTLTFGVTSTGGQTLVFQNIVPAWWKFGQ
SFSSNLQFSY*
>OsEXPA16
MSSVLLFLLLLLLSGVSLSGCIRLGSGGYEEWRMGSATYIKESLGHPLND
GGGACGYGDLDIFRYGRYTAGVSGALFGRGSACGGCYEVRCVNHVLWCLR
GSPTVVVTATDFCAPNLGLSDDYGGWCNFPKEHFEMSEAAFLRVAKAKAD
IVPVQFRRVSCDRAGGMRFTITGGASFLQVLITNVAADGEVAAVKVKGSR
TGWIPMGRNWGQNWQCDADLRGQPLSFEVTGGRGRTVVAYSVAPPDWMFA
QTFEGKQFVE*
>OsEXPA17
MASSWNNPAIFLAAALAVATAAQVVTAGFTTDLYWQQQPAPGAVTPYKTS
DWHDGSATFYGDPSGMGDDFGGACGYVSNDIVSLYSTKTAALSTPLFADG
NGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPR
HHFDMAPPSFLKLAQRVAGIVPVQYRRVPCQRTGGVRFCLQGNHYWLLLY
VMNVGGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVK
LTTYSTPQQTIIVSDAISPWWITGLCYQGSNNFY*
>OsEXPA18
MGNIVLQLLAILALCIAPARSGWLQGTATFYGGADGSGTMGGACGYGNLY
DQGYGINNAALSTPLFNNGASCGQCYLIICNYDKAPSGCRMGTAITVTGT
NFCPPNYDLPYGGWCNTTRPHFDMSQPAWENIGIYSAGIVPILYQQVKCW
RSGGVRFTITGLNYFELVLVTNMAGSGSIASMSVKGSSTGWIQMSRNWGA
NWQCLAGLAGQALSFTVTSTGGQTIVFDSVVPAGWSFGQTFSTYQQFDY*
>OsEXPA19
MGNIFLQLLAVVALCIAPARSDWLPGTATFYGGADGSGTMGGACGYGNLY
DQGYGINNAALSTPLFNDGASCGQCYLIICDYSKAPDWCKLGKAITVTGT
NYCPPNYDLPYGGWCNATRPHFDMSQPAWENIGIYNAGIIPILYQQVKCW
RYGGVRFTINGFNYFELVLVTNMAGSGSIASMSVKGSCTGWIQMTRNWGA
NWQCLAGLAGQALSFNVTSTGGQTIVFDDAVPAGWSFGQTFSTYHQFDY*
>OsEXPA20
MGNILLQLLAVVALCIAPARSDWLPGTATFYGGADGSGTMGGACGYGNLY
DQRYGINNAALSTPLFNDGASCGQCYLIICDYGKAPDWCKLGKAITVTGT
NYGGWCNATRPYFDMSQPAWENIGIYSAGIVPILYQQVKCWRYGGVRFII
NGFNYFELVLVTNMPGSGSIVSMSVKGSCTGWIQMTRNWGANWQCLAGLA
GQALSFNVTSTGGQTIVFDDAVPAGWSFGQTFSTYHQFDY*
>OsEXPA21
MAPPSLPILLVLLSLSSSLSSSSAAAAGRWTDAHATFYGGADASGTMGGA
CGYGNTYGQGYGTDTAALSAVMFGDGLSCGACFELRCGGGGGGDRRGCLP
PAAGKSIVVTATDLCPANHALPGDRGGWCNPPLHHFDLSQPAFLRIARFQ
SGIVPVSYRRVACRRKGGMRFTINGHSYFNLVLVSNVGGAGDVHAVAVKA
GGGRKARWQAMARNWGQNWQSGALLDGQALSFTVTTGDRRSVVSYNVAPA
GWAFGQTFTGRQFT*
>OsEXPA22
MAPARPFALLFLAVTVGFVLLTAADDSANATATTTTAMAPSSSTDDAAPP
VWLKAHATFYGGADASGTMGGACGYGDLYSQGYGTRNAALSTALFNDGAS
CGQCYKIACDRKRAPQWCRPGVTVTITATNFCPPNWDLPSDNGGWCNPPR
PHFDMAQPAWEKIGIYRAGIIPVIYQRVPCVKKGGVRFTINGHDYFNLVL
VTNVATTGLIKSMDVMGSNSTDWLPMVRNWGANWHSLSYLTGQMLSFRVT
NMDGQTLVFRNIVPSGWKFGQTFASKLQFK*
>OsEXPA23
MAPARAFVLVLLAVASASTAAANTATTTPTNPVAAPTQWQKAHATFYGGA
DASGTMGGACGYGNLYSQGYGTRNAALSTALFNDGASCGQCYKIACDRKR
APQWCKPGVTVTITATNFCPPNWNLPSDNGGWCNPPRPHFDMAQPAWEKI
GVYSAGIIPVIYQRVPCVKKGGLRFTINGHDYFQLVLVTNVAAAGSIKSM
EVMGSNTADWMPMARNWGAQWHSLAYLTGQGLSFRVTNTDDQTLVFTNVV
PPGWKFGQTFASKLQFK*
>OsEXPA24
MADMAPARALALVLLAVAVGSALMAAAQDAPSPPTPMAPSPSTDETPPVW
LKAHATFYGGADASGTMGGACGYVDLYSQGYGTRNAALSTALFNDGASCG
QCYKIACDRKRAPQWCKPGVTVTVTATNFCPPNWNLPSDNGGWCNPPRPH
FDMAQPAWEKIGIYRAGIIPVMYQRVPCVKKGGVRFTINGHDYFNLVLVT
NVATTGSIKSMDIMGSNSTDWMPMVRNWGANWHSLSYLTGQMLSFRVTNM
DGQTLVFRNIVPSGWKFGQTFASKLQFK*
>OsEXPA25
MEYAILFATSLVITVLAASGFAPAHGWNKGTATFYGGADASGTMGGACGY
GNLYTAGYGTNTAALSSVLFNDGWSCGQCYLIMCDAAATPQWCRAGAAVT
ITATNLCPPNWALPSNSGGWCNPPRPHFDMAEPAWLQIGIYKAGIIPVLY
QQVKCWRQGGIRFTMGGFNFFELVLVSNVAGSGSVRSVSVKGGSTGWITL
NRNWGANWQCNSGLVGQALSFAVTSTGGQTLYIYNVVPSWWSFGMTFTSN
QQFSY*
>OsEXPA26
MAPLPLLTTTSLLLFFFLASSFAADVVVAGGGGGGGGYDGGGDGEGGGGG
DGEGGGGGGGAKMPHVNHGRYKCGPWVDGHATFYGGRDASGTTEGGACGY
KDADGYGAMTAAVSPALFDNGAGCGACYELKGDSGKTVVVTATNQAPPPV
NGMKGEHFDLTMPAFLSIAEEKLGVVPVSYRKVACVRQGGIKYTITGNPS
YNMVMVKNVGGAGDVVKLTVKGTKRVKWTPLQRSWGQLWKTEANLTGESL
TFRVMTGDHRKATSWRVAPRDWTYDNTYQAKKNF*
>OsEXPA27
MGAMAENLLVLCTILAARMALAAADDWIPATATFYGGNDGSGTMGGACGY
GNLYDQGYGLENAALSTALFNDGAACGQCYLIVCDTDKAGRWCKPRGAVT
VTATNLCPPNWALPSDGGGWCNPPRRHFDMSQPAWERIGVYRAGIVPVLY
RRVRCWRRGGVRFTVGGFDHFELVLVANVAGSGSVAAVSVRGAGTGWLQM
SRNWGANWQSLAGLAGQPLSFGVTTTGGQYILFQDVAPAGWKFGQTFSTS
KQFDY*
>OsEXPA28
MVIRFFAVLAAALCITSASAAAAGGWVSGTATFYGGKDASGTMGGACGYG
NLYTQGYGVYNAALSTALFNGGASCGQCYLIMCDASKTPEWCKAGTAVTI
TATNLCPPNWALANDDGGWCNPPRPHFDMSQPAWETIGIYRAGIVPVLYQ
QVKCWRQGGVRFTVSGFNYFELVLITNVAGSGSVQAMSVKGSKTGWIPLA
RNWGANWQCNSALVGQALSFRVTSTGGQTLQINSVVPEWWEFGTTFTSNQ
QFDY*
>OsEXPA29
MARRGHVFAVVAFVSYALLAAASTTVEAFAASGWSKGTATFYGGSDASGT
MGGACGYGNLYTQGYGTRTAALSTALFDDGASCGQCYALTCDARADPRWC
RAGASVTVTATNFCPPNYALPSDDGGWCNPPRPHFDMAQPAWERIGVYRG
GIVPVAFRRVPCRRRGGVRFTVAGRDYFELVLVTNVAAAGSVRSMEVRGS
RRGAGWMAMSRNWGANWQSLAYLDGQGLSFRVTATDGQTIVFAGVVPPSW
RFGQTFASTQQFM*
>OsEXPA30
MAAASSTTATTAILAAVIISLAGAATTVDAKFRAMQWTPAHATFYGDETA
SETMGGACGYGNLYASGYGTDTAALSTTLFKDGYGCGTCYQMRCVGTASC
YRGSPAITVTATNLCPPNWAEDPDRGGGGWCNPPRAHFDLSKPAFMRMAD
WRAGIVPVMYRRVPCARAGGLRFALQGNPYWLLAYVMNVAGAGDVGDMWV
KAGGGGGWVRMSHNWGASYQAFAQLGGQALSFKVTSYTTGQTILAAGVTP
ASWCFGLTYQARVNFS*
>OsEXPA31
MAMSSRLALCLAVVAACAAGGAVADWSPATATFYGGSDGSGTMGGACGYG
NLYDQGYGVDNAALSQALFNDGASCGQCYLIVCDTSRAPQWCKAGTAVTV
TATNLCPPNWALPSDGGGWCNPPRPHFDMSQPAWEQIGVYQAGIVPVLYQ
RVRCWRQGGVRFTVAGLNYFELVLITNVAGSGSVASAWIKGTNTGWIQMS
RNWGANWQSLAGLAGQALSFAVTTTGGQYLQFQDVAPAWWQFGQTFSTYQ
QFDY*
>OsEXPA32
MWCTWALGRVVLAVVFLVALAAGDAAPPKVHRNHGKFTAGPWKQAHATFY
GGRDGSGTLDGACGYKDTSKEGYGVQTVAVSTPLFGAGAGCGACYEVKCV
DSPDGCKVGAAPLVVTATNLCPPNPGQSNDNGGWCNPPREHFDLSMPAFL
QIAQEKAGIVPISYRRVPCVKVGGIRYTITGNPYFNLVMVSNVGGAGDVA
GLSVKGNKRVKWTPLKRNWGQEWQTSEVLTGESLTFRVMTGDHRKATSWH
VLPPDWQFGVTYQATKNFN*
>OsEXPA33
MAMPVVQVLLLCALAYQAVDAQWTPATATFYGGSDGAGTMGGACGYGNLY
NAGYGLNNAALSSALFNDGAMCGACYTIACDTSQSTWCKPGTSITITATN
LCPPNYAKKSDAGGWCNPPRKHFDMSQPAWTSIAIYQAGIVPVNFKRVPC
QKSXGIRFTISGRDYFELVTVFNVGGSGVVAQVSIKGSKTDWMAMSRNWG
QNWQSNAYLNTQSLSFKVKLDDAREVTVWNIAPSNWNFGTTYTSNINF*
>OsEXPB1
MASSSLLLACVVVAAMVSAVSCGPPKVPPGPNITTSYGDKWLEAKATWYGAPKGAGPKDN
GGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPEACSDKPALIHVTDMND
EPIAAYHFDLSGLAFGAMAKDGKDEELRKAGIIDTQFRRVKCKYPADTKITFHIEKASNP
NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG
GEKIIAEDAIPDGWKADSVYKSNVQAK*
>OsEXPB2
MAGASAKVVAMLLSVLATYGFAAGVVYTNDWLPAKATWYGQPNGAGPDDNGGACGFKNTN
QYPFMSMTSCGNEPLFQDGKGCGACYQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDL
SGTAFGAMARPGLNDQLRHAGIIDIQFRRVPCYHRGLYVNFHVEAGSNPVYLAVLVEFAN
KDGTVVQLDVMESLPSGKPTRVWTPMRRSWGSIWRLDANHRLQGPFSLRMVSESGQTVIA
HQVIPANWRANTNYGSKVQFR*
>OsEXPB3
MAFSISKKAAVAALFSFLVVTCVAGARPGNFSASDFTADPNWEVARATWYGAPTGAGPDD
DGGACGFKNTNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMN
YYPVSKYHFDLSGTAFGAMAKPGQNDQLRHAGIIDIQFKRVPCNFPGLKVTFHVEEGSNP
VYFAVLVEYEDGDGDVVQVDLMEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNES
GKQLVASQVIPANWAPMAVYRSFVQYSS*
>OsEXPB4
MGSLSSLAAAAVFLSLLAVGHCAAADFNATDADADFAGNGWDFNSSDAAVYWGPWTKARA
TWYGQPNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCGSCYKIRCTKDQSC
SGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGIIDIEFTRVPCEFPG
LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTGKWTPMRESWGSIWR
LDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQYS*
>OsEXPB5
MVSRGTFVFAVLVALPILSLPVSGYEQNYTAGRRSTMSLGRGYGWSSGGATWYGGPQGDG
SEGGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSCYQIKCTGNRACSGRPVTVVITD
SCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGVLKIQYKRVPCRFAMNVAFKVDA
GSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKAMQQSWGATWRLNSNTGKPLSPPFS
IRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNYAA*
>OsEXPB6
MAARMGSKVAAILAILSVLVVHGSCKGHPVNYNVSDASAYGSGWLPARATWYGAPTGAGP
DDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCGSCYQIRCNKDPSCSGNIETVIITD
MNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGIIDIQFRRVPCNYPGLKINFHVEEGS
NPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATGVWTPMRESWGSIWRLDSNHRLQAPF
SLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQFS*
>OsEXPB7
MAGRSRRRSFWSVGVAAALLCLLAAHGCSAKHHKPKPTPGGISGNASSSSSNSSTPSIPP
PVAPTPTAPTPPIPSPGTGSSNGSSGGGGGGWLNARATWYGAPNGAGPDDNGGACGFKNV
NLPPFSAMTSCGNEPLFKDGKGCGSCYQIRCVGHPACSGLPETVIITDMNYYPVSLYHFD
LSGTAFGAMAKDNRNDELRHAGIIDIQFRRVPCQYPGLTVTFHVEQGSNPVYMAILVEYE
NGDGDVVQVDLMESRYSTGGVDGTPTGVWTPMRESWGSIWRLDTNHPLQGPFSLRITNES
GKTLIADQVIPADWQPNTVYSSIVQFD*
>OsEXPB8
MVSGDVGVVVYYLLLVLVVVQGCKGSSAVQGEGRWYNESEAIGGAAAWGNAKATWYGQPN
GAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVRCNRNPACSGNAQTV
AITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFARVPCEFPGLKVGFHV
EEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWGSVWRLDSNHRLRAPF
SIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQYSS*
>OsEXPB9
MGSLTTNIVLAVAVVAALVGGGSCGPPKVPPGPNITTNYNAPWLPARATWYGQPYGSGST
DNGGACGIKNVNLPPYNGMISCGNVPIFKDGRGCGSCYEVKCEQPAACSKQPVTVFITDM
NYEPISAYHFDFSGKAFGAMACPGKETELRKAGIIDMQFRRVRCKYPGGQKVTFHVEKGS
NPNYLAVLVKFVADDGDVIQMDLQEAGLPAWRPMKLSWGAIWRMDTATPLKAPFSIRVTT
ESGKSLIAKDVIPVNWMPDAIYVSNVQFY*
>OsEXPB10
MASSCLLLACVVAAAMVSAVSCGPPKVPPGPNITAAYGKQWLEARGTWYGKPKGAGPDDN
GGACGYKDIDKAPFLGMNSCGNDPIFKDGKGCGSCFEVKCSKPEACSDKPVIIHITDMNT
EPIAAYHFDLSGHAFGAMAKEGKDEELRKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNP
NYFAVLVKYVGGDGDVVKVELKEKGSEEWKPLNESWGAIWRIDTPKPLKGPFSLRVTTES
DQKLVANDVIPDNWKANALYKSEIQVD*
>OsEXPB11
MAKSCTLVLLLVALVGLSLLVSPIACSRKLSKPKPKPKPSMKKPVVRAHNNYTGSPSVTV
TTGWAAAGATYYGAPNGDGSDGGACGYQTAVGQRPFSSMIAAGSPSLYKGGKGCGACYEV
KCTTNAACSGQPATVVITDECPGGICLAGAAHFDMSGTSMGAMAKPGMADKLRAAGILQV
QYRRVPCKYSGVNIAFRVDQGANPFYFEVLIEFEDGDGDLNAVDLMEAGCGWTPMVQNWG
ALWRYNSNTGKALKAPFSLRLTSDSGKVLVANNVIPASWKPGVTYRSLVNYS*
>OsEXPB12
MAAFEPHRLQLLYFIAITVLASVFQPCTSIELHRELSGWSNGIATWYGDPNGAGSEGGAC
GYQYAVDQPPFSSRIAAGSPYIYDSGKGCGSCYRVVCAGNEACSGIPVTVVITDQGPGGP
CLEELVDGQCMNEAAHFDMSGTAFGAMARPGQADQLRGAGLLQIQYTRVECEWTGVGLTF
VVDSGSNPNYLALLVEYDDNDSDLAAVDIMPIGAGASGSWIPMQQSWGAVWRLNSGSALQ
GPFSVRLTFSSGQMFVASNAIPAGWNPGMAYQPGGVAMRVRGRNGGRRGYEAVGMLGGLC
HLLLLLLLMLFEL*
>OsEXPB13
MASSSLLLASVVVAAMVSAVSCGPPKVPPGPNITASYGDKWLEARATWYGAAKGAGRKDN
SGACGYKDVDKAPFLGMNSCGNDPIFKDGKGCGSCFEIKCSKPKACSDKPVLIHVTDMND
EPIAAYHFDLFGLAFGAMAKDGKDEELRKAGIIDT*FRRFKCKYPADTKITFHIEKASNP
NYLALLVKYVAGDGDVVEVEIKEKGSEEWKALKESWGAIWRIDTPKPLKGPFSVRVTTEG
GEKIIAEDAIPDGWKADSVYKSNVQAK*
>OsEXPB14
MALAAKLLPSIVAFVALACCVLRSSVASVDHHRKLSGWSIGGATWYGPANGSGTDGGACG
YQGDVGQPPFNSMIAAGSPSIYESGKGCGSCYQVKCSGNPSCSGKPVTVVLTDLCPGGAC
LEEPVHFDLSGTAFGAMAKPGQDDQLRNAGKLPVQYARVPCKWQGVDIAFRVDAGSNQYY
LAVLVEDEDGDGDLSAVDLMQSGGSGGGGSWAAMQQSWGAVWKYNSGPAPLQAPMSIRLT
SGSGRTLVASNVIPAGWQPGGTYRSIVNFRRED*
>OsEXPB15
MASRFQLILSTFVVIAAVTMLPRPCASIEFHRKLSSWSNGGATWYGAANGAGSDGGACGY
QGAVFQAPFSSMIAAGSPSIYKSGLGCGSCYQVKCTGNSACSGNPVTVVLTDECPGGPCL
SEPVHFDLSGTAFGAMANPGQADQLRAAGVLQIQYNRVPCNWGGVKLTFVVDVGSNPNYF
AVLVKYENGDGDLSGVELMQTGAGAAWTQMQQSWGAVWKLNAGSALQAPFSIRLTSSSGK
TLVASNVIPSGWKPGMSYISTVNF*
>OsEXPB16
MLIRSVLFVSLLSAAFVFDSGEAGAAHRVVDPEWHPATATWYGSADGDGSDGGACGYGTL
VDVVPMKTRVGAVSPVLFKGGEGCGACYKVRCLDASICSRRAVTVIVTDECPGGVCAFGR
THFDLSGAAFARLAVAGHGGQLQNRGEISVVYRRTACKYGGKNIAFHVNEGSTTFWLSLL
VEFEDGDGDIGSMQLKQANSAQWQDMKHIWGATWSLTPGPLVGPFSVRLTTLTTRQTLSA
QDVIPKNWTPKATYTSRLNFA*
>OsEXPB17
MAAASSRSFSLCVLLLLLLLAPPISASFLFDGGKSKSAAAAAAVDMEWRPATATWYGDAE
GDGSTGGACGYGSLVDVVPMKARVGSVSPVLFKDGEGCGACYKVKCLDHGICSRRAVTVI
VTDECPGGLCAFGRTHFDLSGAAFSRMAVAGAGGHLRDRGQLSVVYRRTACKYGGKNIAF
RVNEGSTNFWLSLLVEFEDGQGDIGSMQIKQANSVEWLDMKHVWGATWCLVRGPLVGPFS
VRLTTLSAQKALTARDVIPRNWKPTATYTSRLNFEAAL*
>OsEXPB18
MNSKFQLILSTFVVIAAFTLLPRPCASIEFHRKLSSWSNGGATWYGAANGAGSDGGACGY
QAAVDQAPFSSMIAAGSPSIYKSGLGCGSCYQVKCSGNSACSGNPVTVVLTDECPGGPCL
SEPVHFDLSGTAFGAMANPGQADQLRAAGVLQIQYNRVPCNWGGVMLTFAVDAGSNPSYF
AVLVKYENGDGDLSGMDLMQTGAGAAWTPMQQSWGAVWKLSAGAALQAPLSIRLTSSSGK
TLVASNVIPSGWKPGASYTSTVNY*
>OsEXLA1
MAVSVRCCFGSSSLSHHARLLLVIVALLAPRLASGCDRCVRRSRAAYYTSSLTLTAGSCGYGTAAATFNG
GGFLAAAGPALYRGGVGCGACYQVRCKDKKLCSNAGARVVVTDRARTNRTGLVLSSPAFAAMARPGMAAS
LTELAAVDVEYKRVPCEYRHRSLSVRVDERSRGPNELTISFLYQGGQTDIVAVDVAQVGSSSWKFMTREH
GPSWSMANAPPGPLQMRLVVTGGYDGKWVWADREVLPRRWRAGEVYDTGVQITDIAQEGCFPCDTHEWK*
>OsEXLA2
MAVRCCSSMASASVVLFFVVVGMSASMVSGCDRCVRRSKAGFRDSSIALNAGSCGYGSLAASFNGGHLAA
ASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDEARSTNRTDLVLSAAAYAAMARPGMAAQLRTRR
AVDVEYKRVPCEYAAGRNLSIRVEEKSRPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAW
STAQAPAGPLQFRVVVTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQIADVAQEGCYPCDTQEWK*
>OsEXLA3
MAVLLSILSSSFLLLLAASSSSTPRASACERCVRNGKAAYSPSLSPLPPGGGGGCGYGAMAMEMELNGGF
LAAGGPRQHRGGLGCGRCFQMRCRNAEVCSNAGVRVVLTDFHRSNSTDFLLGGPAFAGLAKPGMAHKLKK
LDALSVEYRRIPCDYKDKNLSILVEEQSKRPNNLVIKFLYQGGQTDILAVDVAQVGSSDWRFMTRVYGPV
WSIDRAPNGPLQFRAVVTGGYDGKWVWADREVLPANWQPGQVYDTGARIADVARESCLDCATLDWK*
>OsEXLA4
MDDNGDVHFCHRATAVVALLLLHLVVVANAAAHSCDWCTPRHSTVSILPTPTHAAHLTGGACGFGAAPME
LNVAAVTADLFRHGHACGACYQLRCRDRRLCGEDGVKVVVADMAKQPEQEGEMNRTAGGSLQFRITEDAF
AAMAKQGVSAHELTRQRTLEVDFRRIPCEYRESRRLAVRVEEASRNPTHLAIRFLYQGGQTDIAAVEIAQ
ANATPPSSSYYSSWRYMTRRDGAPGVWTTSRAPVGPLRLRVVVTAGSGGKWLRSDGEVLPADWRPGEVYD
TGLRVTDVAVRSCSLSCAIQDMDSDDGEEEELR*
>OsEXLB1
MAQLLRRHLPVILSLILFLSKATADANFTVSRAAYYPNSDIKGTENGACEYGAFGATLNNGDVSASASLY
RDGVGCGACYQVRCTNPYYCSPNGVTIVITDSGASDGTDFILSQHAFTRMAQSTDAGTALLTLGVVGIEY
RRVSCTYPNKNIVFKITESSNFPNYLEFEIWYQQGNQDIIAVQLCETVNLTCQLLSRTHGAVWAAVSPPS
GPLSIRMLFSSGAPRGGDTWLVPTNIVPQNWTAGATYDSGVQVQLQ*

horizontal rule

Names and protein sequences for the expansin superfamily in poplar, in FASTA format.
The genomic location is provided after the protein name in the format used by the preliminary draft (version 1.0)
of the annotated
Populus trichocarpa genome (http://genome.jgi-psf.org/Poptr1/Poptr1.home.html). Names and
sequences based on Sampedro et al. (2006). After the location, the intron pattern is indicated between brackets
and follows the naming conventions in Sampedro et al. (2005).

>PtEXPA1 LG_I: 17641192- 17643141 [AB]
MAMSSLICIATSLLIIMSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLTCGSCFEIKC
ASDPRWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISN
VAGAGDIVQVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIAPAHWQFGQTFTGKNFRV
>PtEXPA2 LG_XIII: 12409755-12411121 [AB]
MAAQTFASCLLLFICLHLQSILADYGGWQGGHATFYGGGDATGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACYEMRCDDDPKWCLP
GTITVTATNFCPPNPSLPNNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVPCVKKGGIRFTINGHSYFNLVLITNVGGAGDVHSVSI
KGSKTGWQAMSRNWGQNWQSNNYLNGQSLSFQVTTSDGRTVTSYNAVPAGWQFGQTFEGGQF
>PtEXPA3 LG_X: 15305914-15307378 [GAB]
MALAGIFLVGFLAMVSSVYGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIRCVNDPKWCLPGSI
VITATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIAQFRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHSVSIKGSR
TGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNAAPSSWSFGQTFSGAQFR
>PtEXPA4 LG_VIII: 5494454-5492987 [GAB]
MKMALAGFILVGLLAMVSSVNGYGGGGWINARATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNSGLSCGSCYEIRCVNDPKWCLPGS
ILVTATNFCPPNNALPNNAGGWCNPPQHHFDLSQPVFQHIARYSAGVVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVSVKGSR
TGWQPMSRNWGQNWQSNNYLNGQSLSFKVTTSDGRTVVSYNAAPSSWSFGQTFSGAQFR
>PtEXPA5 LG_IX: 8651315- 8653100 [AB]
MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDP
QWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAGDIV
QVSVKGSKTGWMSMSRNWGQNWQSNAVLVGQSLSFRVRASDRRSSTSWNIVPAHWQFGQTFTGKNFRV
>PtEXPA6 LG_IV: 12264817- 12264040 [AB]
MALLGFLLVGFLSSVSSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFDNGLSCGSCFEIRCVNDPQWCLPGVIVVTA
TNFCPPGGWCDPPNHHFDLSQPVFQHIAQYRAGIVPVIYRRIRCRRSGGIRFTINGHSYFNLVLITNVGGAGDVHSVAIKGSRTGWQSMSRNWGQNWQ
SNSYLNGQSLSFVVTTSDGRSVVSYNVAPAGWSFGQTYSGGQYRY
>PtEXPA7 LG_VIII: 3138797- 3137266 [AB]
MTDRATISFISLVLLLSLVEARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGS
PSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGDIVKVSVKGSRTG
WMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFGQTFAGKNFRV
>PtEXPA8 LG_IV: 7510300- 7508403 [B]
MPPPLPQNPIHTLLKPLLLLLFIFPTATTSLTSSTTTPPPLSTTLSQWQSARATYYAASDPRDTVGGACGYGDLVKAGYGMATVGLSESMFERGQICGACF
ELKCVDDLRWCIPGTSIIVSVTNFCAPNYGFTSDGGGKCNPPNKHFVLPIEAFEKIAIWKAANMPVQYRRIKCRKEGGIRFNISGSGIFLSVLISNVAGAG
DVTAVKIKGSRTGWLDMGRNWGQNWHVNANLQNQALSFEVTSSDRMTVISYNVAPKDWRFGQAFEGKQFET
>PtEXPA9 LG_XVII: 4946302-4945365 [AB]
MAPFGFLLVGFLSIVSSVHGYYGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGANTAALSTALFDNGLSCGACFEIRCVNDPKWCLRGSIVVTATNFC
PPGGWCDPPNKHFDLSQPVFQHIAQYRAGIVPVIYRRHVKQQLTVVRCRKSGGIRFTINGHSYFNLVLITNVGGAGDVRSVAIKGSRTRWQAMSRNWGQNWQ
SNAYLDGQSLSFLVTTSDGRRVVSYNVAPAGWSFGQTYSGGQFRY
>PtEXPA10 LG_I: 95602-96582 [AB]
MECLGYTIVILLTMLKIVKGYGTGWTGAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACYEIKCVNDNIWCLRGSITVTATNFCPPNNALPNNDGGWCNPPQQHFDLSQPVFQKIAQYKAGIVPVQYRRVACRKSGGIRFTINGHSYFNLVLITNVGGAGDVVAVSIKGTKSNWQAMSRNWGQNWQSNTYLNNQALSFKVTTSDGRTVVSNNVAPSNWAFGQTYTGRQF
>PtEXPA11 LG_XIII: 4465194-4464276 [AB]
MNFLGICLVVFLTMSKTVHGYGGGWSDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFKNGLTCGACFELKCVNDARWCLSGSIIVTATNFCPPNSAGGWCNPPSQHFDLSQPVFQHLARYKAGIVPVLYRRVACRKTGGIRFTINGHSYFNLVLITNVGGAGDVVSVSIKGSRTGWQPMSRNWGQNWQSNSYLNGQALSFKVTTSDGRSIISSNVAPPNWAFGQTFHGGQF
>PtEXPA12 LG_XIX: 7684758-7683364 [AB]
MTMAATISLLLFALHLCLIGTYGDSGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCDNDPKWCLPGSITVTATNFCPPNSALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHSVSIKGSKTGWQAMSRNWGQNWQSNSYLNGQSLSFQVTTSDGRTVTSYNAVPEDWQFGQTFSGGQF
>PtEXPA13 LG_XVI: 12989757-12988728 [AB]
MAIKAMQDFVFVQLYLVLSFLLHGIYGDYGGWQVGHATFYGGSDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACFQIRCNNDPKWCHSGTITVTATNFCPPNYALSNDNGGWCNPPLKHFDLAQPAFLQIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTGWQTMSRNWGQNWQSNSYLNGQRLSFRVTTSDGKTVTWYNVVPANWQFGQTFAGGQL
>PtEXPA14 LG_VI: 7631726-7630616 [AB]
MQFSVFLQLFLVFSLLFHGTCGDRGGWQIGHATFYGGSDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGACFQIRCNNDPKWCHSSTITVTATNFCPPNYALANDDGGWCNPPLQHFDLAQPAFLKIAQYRAGIVPVLFRRVPCVKKGGIRFTINGHSYFNLVLITNVAGAGDVHAVSVKGSRTGWQTMSRNWGQDWQSNSYLNGQSLSFRVTASDGTTVTSYNIVPANWQFGQTFEGGQF
>PtEXPA15 LG_X: 17816218-17817576 [AB]
MAIRATICVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLITNVAGAGDIVKVSVKGSKTGWMSMSRNWGQNWQSNSVLVGQSLSFRVTGSDRRTSTSWNVVPSNWQFSQTFVGKNFRV
>PtEXPA16 LG_VI: 5754972-5753575 [AB]
MAHHRLGLLCIVFLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGDIVNVWIKGSETDWMSMSRNWGQNWQSNAVLVGQSLSFRVRGSDGRTSTSKNVASPNWQFGQTFTGKNFRI
>PtEXPA17 LG_II: 1033512-1034469 [AB]
MGKLLLAFAIWLQFCNYFAINVNAFAPSGWTKGHATFYGGSDASGTMGGACGYGNLYSTGYGTRTAALSTALFNDGASCGECYRIMCDFQTDSRWCIKGRSVTITATNFCPPNFALPNNNGGWCNPPLQHFDMAQPAWEKIGIYRGGIVPVLFQRVPCKKHGGVRFTINGRNYFELVLITNVAGAGSIQSVSIKGSKTGWLAMSRNWGVNWQSNAYLNGQSLSFKVTTTDGQTRFFTDIVPANWGFGQTFQSSVQF
>PtEXPA18 LG_V: 16994241- 16993284 [AB]
MGKFLLTFAILLQFCSYLAINVNAFAPSGWRKGHATFYGGSDASGTMGGACGYGNLYSTGYGTRTAALSTALFNDGASCGECYRIMCDFQTDPRWCIKGKSVTITATNFCPPNYALPNNNGGWCNPPLQHFDMAQPAWEKIGIYRGGIVPVLFQRVPCKKHGGVRFTINGRNYFELVLISNVAGAGSIQSVSIKGSKTGWMAMSRNWGANWQSNAYLNGQSLSFKITNTDGQTRFFTDIAPANWGFGQTFSSSVQF
>PtEXPA19 LG_II: 14477908-14478909 [AB]
MASLSVLSCAVFLFLGIYCTQFHSASAAWQQAHATFYGGSDASGTMGGACGYGNLYTDGYGIKTAALSTALFNDGKSCGGCYQIICDSTKVPQWCLRGKYITITATNFCPPNYNLPNDNGGWCNPPRPHFDMSQPAFQTIAKYRAGIVPILYRKVGCDRSGGIRFTINGKNYFELVLISNVGGAGDISRVWIKGSKSNQWEAMSRNWGSNWQSLSYLNGQSLSFKIQTSNGQTRTALNVAPSNWVFGQSFKSNVQF
>PtEXPA20 scaffold_107: 690700-692116 [AB]
MGPFVTLSVLVCQFLFFVCLLSLKGINGGWLNAHATFYGANQSPATLGGACGYDNTFHAGFGVNTAAVSGALFRGGEACGACYQLMCNYRADPKWCLRRAVITVTATNFCPPNNNGGWCDPPRQHFDMSMPAFFRIARQGNEGIVPVLYRRVSCTRRGGVRFTLRGQSNFNLVMISNVGGSGDIKAAWVRGSRARSWVPLHRNWGANWQSSFDLRNQKLSFKLTLVDGKTLEFFNVVPSTWMFGQTFSSRSQ
>PtEXPA21 LG_IX: 98407-97421 [AB]
MGALKAILLYLIIHQTWKITADDEEWKSATATYVKETSGSIIVEGACGYGDLHRATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSSDYGGWCNFPKEHFDMSEAAFAEIAEKKADVVPVQHRRVKCDRRGGLRFTMSGNFHFYQVLISNVGLDGEVIAVKVKGSRTAWIPMARNWGQNWQSNINLIGQPLSFEVTTSSRRTLTSYNVAPANWQFGQIFEGKQF
>PtEXPA22 scaffold_66: 1483542-1484526 [AB]
MGALKAMLLYLIIHQTWKITADDEEWKSATATYVKETNGSIVVEGACGYADLHKATYGKYSAGLSSMLFNRGSTCGACFEVRCVDHILWCLQGSPSVILTATDFCPPNYGLSADYGGWCNFPKEHFDMSEAAFTEIAEKKADIVPVQHRRVKCERRGGLRFTVSGNFHFYQVLISNVGLDGEVIAVKVKGSKTAWIPMARNWGQNWQSNVNLIGQPLSFEVTTSSRKTLTSYNVAPANWQFGQTFEGKQF
>PtEXPA23 scaffold_44: 1815451-1813597 [B]
MPPPLLQGPIHTLLKPLLLLLLLLTLPPTTTSHTSSTTTPPPLSTYLSQWQPARATYYAASDPRDTVGGACGYGDLVKAGYGMATVALSESMFERGQICGACFEIKCVDDLRWCIPGTSIIVSVTNFCAPNYGFPSDAGGKCNTPNKHFVLPIESFEKIAIWKAANMPVQYRRIKCRKEGGIRFTISGSGIFLSVLISNVAGAGDVTSVRIKGSRTGWLDMGRNWGQNWHVNANLQNQALSFEVTSSHKMTVLSYTVAPKDWRFGQTFEGKQFET
>PtEXPA24 LG_I: 8490503-8489168 [AB]
MASFFHSWSFSLFLIVLTSAMFIGKSMAVGYGKARVPTVFRPSQWSLAHATFYGDETARETMGGACGYGNLFQTGYGTNTAALSTTLFNNGYACGTCYQIKCTNAPACYGVITTVTATNICPPNWSQDSNNGGWCNPPRVHFDMSKPAFMKIAQWKAGIVPVMYRRVPCARTGGLRFKLQGNGYWLLVYVMNVGGGGDIASMWVKGSKTGWISMSHNWGASYQAFASLRGQALSFKITSYTTKQTVIALNVAPSTWGAGMTYKSTVNFS
>PtEXPA25 LG_XVI: 8651354-8652601 [AB]
MASPLKSILATLLLLAIALPDCQAKSKPSLLGKQAIHHAIGRQANHIELPKRHKPKFRPGPWKKAHATFYEGGSGTFGGACNYKDVAGEGYGMNTVALSSVLFRNGQACGACFEIKCADSPQWCKLGQPSLFVTATDHCPPNPSLPNDNGGWCNVPREHFDIAKPVFSQLAGYKAGIIPIQYRRLPCKKQGGIRFTILGNPWFYQVIVWNVGGAGDVVSVQVKGDDKLKWTQMERDWGATWKTSAILHGESLSFRVRASDERYSTSWHVTPKNWQFGQTYEGKNFK
>PtEXPA26 LG_XVI: 8873321-8872064 [AB]
MASPLKPMLATLLLLAIAFPNCQAKSKPSLSGKQAIHHAIGRLAHDIEIPKRNKPKFQPSPWKEAHATFYEGGSGTFGGACNYKDVAGQGYGMNTAALSSVLFKNGQACGACFEIKCADNPQWCKLGQPSLIVTATDHCPPNPSLPNDNGGWCNVPREHFDVAKPVFSQLAEYEAGIIPIQYRRVPCQKQGGIRFTILGNPWFYQVIVWNVGGAGDVVGVQVKGDDKLKWTQMERDWGTTWKTSAILLGESLSFRVSASDDRDSTSWHVTPKNWQFGQTYEGKNFK
>PtEXPA27 LG_XVII: 5640405-5641332 [A]
MASFKNSFACLVLMALLGVARSDQISFGEKIDSSWYDAHATFYGDIKGGQTMMGACGYGDLFKQGYGLQTAALSTALFNNGQTCGACFELKCVNDPQWCKNHAGTIKITATNLCPPNYGASNAWCNPPQQHFDLSMPMFLTIAEYRAGIVPVKYRRILCSKEGGVKFDIHGNPYWMLVLVRNVAGAGEVINVRIKGSQTRWIQMSRNWGQNWQTGTDLVGQSLSFLVTTSDYKRLYFNDVAGADWSFGQAYDGKINF
>PtEXPB1 LG_XIV: 1151361-1149937 [ACB]
MAIISFQNPFHLPIILAFFLVNSCHCFHPKLFNVSKIQSNSDWSPAGATWYGSPTGAGSDGGACGYGNAVEQAPFSSFISAGGDSIYKSGQGCGACYQVKCTSSSNAACSGNPVTVVITDQCPGSPCAQESFHFDLSGTAFGAMAISGKEDQLRNAGVLQIQHQRVPCNWPGKTVTFHVDSGSNPYYFATVVEYEDGDGELKSVELKQALDSDSWVPMQKSWGAVWKLDAGSLLRAPLSIKLTSLESGKTIVASGVIPAGWAPGQTYRSLVNFN
>PtEXPB2 scaffold_120: 669557-667616 [ABF]
MQLLGLYVVVFLKCFLGVFGQQVHPQHNVADLHWKPATATWYGSPDGDGSDGGACGYGSLVDVKPFRARVGAVSPVLFKNGEGCGACYKVRCLDKSICSRRAVTIIVTDECPGGYCSNGNTHFDLSGAAFGRMAISGENGQLRNRGEIPVIYRRTPCKYPGKNIAFHVNEGSTDYWLSILVEFEDGDGDVGSMHIREAGGTEWLEMNHVWGATWCIIRGPLKGPFSVKLTTLTTGRTLSAREVIPRNWAPKATYTSRLNFFH
>PtEXPB3 LGXIII: 11437343-11439709 [ABF]
MQLLGLHVVMLLKCFLVVFGQQYHTHHDVADLHWKPATATWYGSPDGDGSNGGACGYGSLVDVKPLRARVGAVSPILFKNGEGCGACYKVRCLDKSICSERAVTIIVTDECPGGYCSNGNTHFDLSGAAFGHMAISGENGQLRNRGEIPVIYRRTPCKYPGKNIAFHVNEGSTDYWLSLLVEFEDGDGDVGSMHIREAGGTEWLEMNHLWGANWCVIRGPLKGPLSVKLTTLSTGRTLSARDVIPRNWVPKATYTSRLNFFH
>PtEXLA1 LG_IV: 16335903-16337584 [ACBF]
MAIFICFLFLAISYATACDRCVHQSKVAYFSRDSALSSGACGYGSMATGFNSGHLAAAVSSLYKDGSGCGACFQIRCKDTTLCSREGTRVIVTDLNRNNQTDFVLSSRAFMAMANKDKGRNILKQGIVEVEYKRVPCEYKNQNLAVRVEESSKNSNYLAIKLLYQGGQTEVVAIDFAKVGSSNWGFMSRNHGAVWDSDRVPSGALQFRFVITAGFDGKWIWARNVLPEDWKPGMTYDSGVQITDIAQEGCSPCDDGIWK 
>PtEXLA2 LG_IX: 1685238-1683619 [ACBF]
MAVFLCFLFLIISSATGCDRCVHQSKVAYFSKASALSTGACGYGSMAIGFNSGHLAAAVSSLYKDGAGCGACFQIRCKNTALCSSRGTTVIVTDLNNNNQTDFVLSSRAFMAMANKGMGQDVLKHGILDVEYKRVPCEYKNQNLAVRVEESSKKPNYLAIKLLYQGGQTEVVAMDVAKVGSSNWGFMSRNHGAVWDTDRVPAGALQFRFVVTAGFDGKWIWAQKVLPEDWKPGMTYDSGVQITDIAQEGCSPCGDGIWK
>PtEXLB1 scaffold_118: 913613-914934 [ACF]
MGFAFKYGYSLLCIMALLPAISYSQDYTFSRATYYGSPDCLGTPSGACGFGEYGRTVNDANVAGVSRLYKNGTGCGGCYQVRCKAPNLCTDDGVNVVVTDYGEGDKTDFILSPRAYARMAHPNMAVELIAYGVVDVEFRRIPCRYSGYNLMFKVHEHSRFPDYLAIILLYQAGQNEILAVELWQEDCKEWRGMRRAYGAVWDMPNPPKGAISLRFQVSGSAGVTYWAQAANVIPSDWKAGIAYDSTVQLS
>PtEXLB2 scaffold_29: 1104459-1103291 [ACF]
MGFALKYGYSILCVVAVALLPAISHSQDYTCSRATYFGSPDCLGTPTGACGFGGYGRTVNDANVAGVSRLFKNGTGCGGCYQVRCKASNLCSDDGVNVVVTDYGEGDKTDFILSTRAYARMARPNMALELFAYGVVDVEFRRIPCRYNGYNLMFKVHEHSRFPEYLAIVLLYQAGQNEILAVELRQEDCKEWRGMRRAYGAVWDIPNPPKGAISLKLQVCGSAGVTWVQADNVLPSDWKAGVAYDSAIQLP
>PtEXLB3 scaffold_29: 1677856-1679534 [ACBF]
MVPTLQFLLFLSGTLLFMQTLAEAATCSDCFIHSRAAYYPNSYENGTDTGRCGYGSFGATLNGGDVSAVSDLYRDGVGCGACYQVRCTDSHYCTDKGVTIVVTDHGSSHNTDFILSRRAFGRMAQTTDAAASLIALGVVDVEYKRVSCSYPNKNITIKIDENSDHPSYMGFVVWYQQGRRDITAVHLCETQNFACKVLDRSYGAVWTTTSPPSGPLSLRMLFSEEDGDETWVVPVNNIPNDWKAGQTYDTGVQVNS
>PtEXLB4  scaffold_118: 556859-555255 [ACBF]
MAPSLRFLLFLSATLFFMQTLTEAATCSDCFIHSRAAYYPNSDENGTDTGRCGYGSFGATLNGGDVAAASDLYRDGVGCGACYQVKCTNSYYCTDNGVTIVITDQGSSDNTDFILSRRAFGRMAQTTDAAASLLALGVVDIEYRRVSCSYPYKNITIKIDENSNYPYYLGFVIWYQQGRSDITAVQLCETQNFVCKLLDRSYGSVWTTTSPPSGPLSLRMLFSDENGDETWVVPVNNIPNDWKAGETYDTGVQVNL

horizontal rule

Names and protein sequences for expansins in papaya (FASTA format), partial listing.
This listing is courtesy of Robert Paull (University of Hawaii). See Tropical Plant Biology 1: 246-277 (2008).
Note that this listing is  is incomplete.
The expansin name is followed by a location designated as
 "EXP_XX.YY" where XX is the supercontig and YY is the gene number on the supercontig.

>Papaya_CpEXPA1_EXP_19.63
MENISAFSMVSLLFVLLINSGLPVAYADYGGWTSGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAAL
STALFNNGLSCGACYEMRCDNDPKWCLPGTITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQI
AQYRAGIVPVSFRRVSCGKKGGIRFTINGHSYFNLVLVTNVGGAGDVHSVSIKGSKTNWQSMSRNWGQNW
QSNSYLNGQSLSFQVTTSDGRTMTSYNLVPANWQFGQTFEGGQF

>Papaya_CpEXPA2_EXP_2.303
MTHGHRGGAQLSSAQRPAVSDSASCNPNQSFPAYKYPLTLIHSDHETNTNMAAPQKFFSSFLFFVFFFVH
EIAADYGGWENAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEMRCNDDP
RWCLPGTITVTATNFCPPNFALSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVAFRRVPCMKKGGI
RFTINGHSYFNLVLITNVGGAGDVHAVSIKGSKTGWQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTL
TSYDVVPEIVSSS

>Papaya_CpEXPA3_EXP_1.46
MASLIFLLLTSLAVVCPVHAYGGGGWTNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFN
NGLSCGSCYEIRCVNDPKWCLPGSVVVTATNFCPPNNALPNNAGGWCNPPLQHFDLSQPVFQHIAQYRAG
IVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGDVHAVAIKGSRTGWQAMSRNWGQNWQSNSYL
NGQALSFKVTTSDGRSVVSYNVAPSGWSFGQTFTGAQFR

>Papaya_CpEXPA4_EXP_14.96
MVPIPHICQVVRRKMKSFFGIVLVGFVSVVSSTVYGYGGGGWINAHATFYGGGDASGTMGGACGYGNLYS
QGYGINTAALSTALFDNGLSCGACYELKCVNDPQWCLPGTIVVTATNFCPPGGWCDPPNQHFDLSQPIFE
HIAKYRAGIVPVMYRRVRCRRSGGIRFTINGHSYFNLVLVTNVGGAGDVRGVSIKGSRTRWQAMSRNWGQ
NWQSNAYLNGQALSFLVTASDGRRVLSYNVAPAGWSFGQTYTGNQFRY

>Papaya_CpExPA5_EXP_119.14
MNLVWCYMLALFTTLKAVKVYGIGWIDAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNN
GLSCGACFEIRCVNDREWCIPGSIIVTATNFCPPNLALANNAGGWCNPPLQHFDLSQPVFLRIAKYKAGI
VPVQYRRVTCRKRGGMRFTINGHSYFNLVLITNVGGAGDVVGVSIKGSKTGGWQAMSRNWGVNWQSNSYL
NGQALSFKVTTSDRRFVISNNVAPTTWTFGQTYTGKQF

>Papaya_CpEXPA6_EXP_51.87
MDVVVGTCLVFFLALLRNIHGYGAGWSSAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFK
NGLACGACFEIKCVNDGRWCLPGSITVTATNFCPPNNALPGNAGGWCNPPLRHFDLSQPVFQHIAHYKAG
IVPVQYRRVSCRKSGGIRFTINGHSYFNLVLISNVGGAGDVVSVSIKGSRTGWRAMSHNWGQNWQSNAYL
NGQALSFKVTTSDRRSVISNNVAPSTWKFGQTFTGRQF

>Papaya_CpEXPA7_EXP_80.51
MVPAAINIFPFCLIIIISLLAEGINGWINAHATFYGVNDNPTTLGGACGYDNTMHAGFGVNTAALSGALF
ENGGACGGCYQVMCNYREDPKWCLPGRIVTVTATNFCPSNNNGGWCDPPRHHFDMSFPAFLRIARRGNEG
IVPVLYRRVSCRRRGGVRFTMRGQSSFNMVMISNVGGSGDVKEAWIRGSRTRTWVAMRRNWGANWQSSVD
LRNQRLSFKLTLGDTKTISFINVVPSSWQFGQTFASHLQFS

>Papaya_CpEXPA8_EXP_81.134
MRREMAMAGTFWMVALLGALMWVAEARIPGVYQGGSWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV
NTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYALPNDNGGWCNPPRSHFDLA
MPMFLKIAEYRAGIVPVAYRRVPCRKMGGIRFTINGFRYFNLVLITNVAGAGDIVRASVKGSKTGWMPLS
RNWGQNWQSNAVLVGQPLSFRVTGSDRRTSTSWNIAPAHWQFGQTFTGKNFRV

>Papaya_CpEXPA9_EXP_260.6
MAASVRSICLAFVLMVTLFSMANARIPGVYSGGPWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGVNT
AALSTALFNDGLSCGSCFEIKCANDPRWCHPGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP
MFLKIAEYRAGIVPVSYRKYPYPDLLSSSYNPKDITPIQTRVPCRKQGGIRFTINGFRYFNLVLITNVAG
AGDIMKVSVKGTKTGWLSMSRNWGQNWQSNAVLVGQALSFRVTASDRRSSSSRNVAPANWQFGQTFTGKN
FRV

>Papaya_CpEXPA10_EXP_1.419
MGILQMSICLVSLMVLLTLVDARIPGVYPGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAA
LSTALFNNGLSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPMF
LKIAEYRAGIVPVSYRRVPCRKKGGIRFQINGFRYFNLVLISNVAGAGDLVKVSVKGSRTGWMSMSRNWG
QNWQSNAVLVGQSLSFRVTASDRRSSTSWNIVPANWQFGQTFTGKNFRV

>Papaya_CpEXPA11_EXP_26.280
MAQLAAILLGFFCYLTITVHAFLPSGWTKAHATFYGGSDASGTMGGACGYGNLYSTGYGTRTAALSTALF
NDGASCGQCYKIMCDYQVDPKWCKKGVSVTITATNFCPPNYALPNNNGGWCNPPLQHFDMAQPAWEKIGI
YRGGIVPVIFQRVPCKKHGGVRFTINGRDYFELVLISNVAGAGSIKSVSIKGSKTGWTAMSRNWGANWQS
NSYLNGQSLSFQVTTTDGVTRVFPNVVPSNWAFGQSFSTKIQF

>Papaya_CpEXPA12_EXP_976.1
MLFASLIIGESKLDSTWYDAHATFYGDIGGSETMQGACGYNDLHQQGYGLETTALSTALFNNGKTCGACF
EIKCVNNPKWCKPNAIIKVTATNFCPPNYSKPNGNWCNPPLKHFDLSLKMFLALAEYKAGIIPVQYRRVT
CTKQGGVKFEIKGNPYWILVLVYNVGGVGDITNVQIRGSETSSWIPMSRNWGVNWQTGKNLVGQSLSFQV
TTSDGKMLEFKDIAASNWQFGATFDGKINF

>Papaya_CpExPA13_EXP_14.166
MASSRNSFKLVIFMASLVVSMSQSEQAWQNAHATFYGDLAGGETMMGACGYGDLHKQGYGLETAALSTAL
FNNGATCGACFEIKCVNTPQWCIPNAGTIKITATNFCPPNYSKPDGNWCNPPLKHFDLSMKMFLTIARYR
AGIVPVQYRRVACIKHGGVKFEIKGNPYWILVLVYNVGGAGDVTRVEIKGSKTNWIPMSRNWGMNWQTGV
KLVGQSLSFRATTSNGKTLQFNNVAASNWQFGSTFDGKINF

>Papaya_CpEXPA14_EXP_5.156
MVSTLRFFHAIVHLILFLVLPQCHASHRHSKKPGSWKQAHATFYEGDTETYGGACGYKDVVQLGYGLDTV
AVSNVLFEEGKGCGGCYEIQCINSQQWCKPGQPSIFVTVTDNCPPSYQSDGWCNPPRQHFDLAKPAYLKI
AEYKAGIVPVQYRRVPCNKQGGIKFTINGHQYWNEVSVWNVAGSGDVKSVQVKGDGKLRWTPLTRSWGHR
WTTGANLTGQALTFRVQGSDGRFSTSWRVTPKNWQFGQTFQGKNFRK

>Papaya_CpEXPA15_EXP_178.23
MAAPLFFLLHSTLLFTLIFVLLLPQVTSHYLSSSSSASSPSAYSQQLSEWRSARATYYAASDPRDAVGGA
CGYGDLVKAGYGMATVGLSESLFERGQICGACFELRCVDDLRWCIPGTSIIVTATNFCAPNYGFDADGGG
HCNPPNKHFVLPIEAFEKIAVWKAGNMPVQYRRIKCRKEGGIRFAIDGGGIFISVLISNVAGAGDIASVK
IKGSRTGWLSMGRNWGQNWHINADLKNQPLSFEVTSSDGSRILSYNVAPKDWNFGQTFEGKQFES


>Papaya_CpEXPB1_EXP_34.142
MQRRGGSGLAFGLWVMVLLEFVTAAVMSAEVARHLDLHWLPATATWYGSPEGDGSDGGACGYGSMVDVRP
MRARVGAVSPVLFKDGEGCGACYKVRCNDRSICSRRAVTIIVTDECPGGYCANGRSHFDLSGAAFGRLAI
TGEGGQLRNRGEIPVVYRRTPCKYPGRNIAFHVNEGSTDYWLSILVEFEDGDGDVGSMHIREAGSSEWLE
MKHLWGANWCIIRGPLRGPFSVKLTTLSTGETLSARDVIPRNWSPKATYPSRLNFFHY

>Papaya_CpEXPB2_EXP_49.141
MLFNFSYCFCSKLHNFSFSQFDSNWSPAAATWYGSPNGAGSDGGACGFGNIVGQPPFSSMVSAGGPSLFK
GCHGCGACYQVKCTSDVNKACSGNPVIVVITDNCPGGPCASDSVHFDLSGTAFGAMANSGGAEQLRSIGK
LTIQYRKVNCNYHGKTMTFHVDSGSTSNYFATLIEYVDGDGELTKVELKQALNSDTWLTMQNLWGALWKL
NSASTLRAPFSIRLTVAGTGETVVANNVIPVNWKAGQTYQSLVNFKH

>Papaya_CpEXPB3_EXP_212.10
MEFSFRCSLYLLLVYLCLLLESCHCFYPKLLNFSDSQTDSDWSPAAATWYGSPTGAGTDGGACGYGPTVD
QPPFSAMVSAGGASLFKEGKGCGACYQVKCTSDDNKVCSGNPVSVVITDNCPGGPCASDSIHFDLSGTAF
GAMANSDDADQLRNAGVLKIQYRKVECNYPQKTVTFHIDSGSNSNYFATLIEYEDGDGELAGVELKQALD
SDTWLPMQQSWGAVWKLDSGSTLRAPFSLRLTAMGTNDTLIVTAVIPAGWQPGQSYRSLVNFKP

>Papaya_CpEXPLA1_EXP_20.162
MALFLPFIFLLFSSATACDRCVHQSKAAFFSKASALSSGACGYGSLALGLGGGHLAAGVPSLFKDGAGCG
ACFEIRCKNKTLCSSKGTTVTLTDLNRSNQTDFVLSSRAFMAMANNGMGKDILKLGIVDVEYKRVPCNYK
KQNLAVRVEDSSQKPHYLAIKLLYQGGQTEIVAMDIAQVGSSNWSFMSRNFGAVWDTSRVPSGALQFRFV
ITAGFDGKWIWAEHVLPADWKNGEIYDTGVQITDIAKEGCSPCDDGTW

Table 3: EXPA (a-expansin) sequences from other species

Plant Genus GenBank Name(s) Comments
Antirrhinum majus unpublished Am-EXP1 contact John Nicols
Cucumis (cucumber) U30382 Cs-EXP1 cDNA, complete cds
U30460 Cs-EXP2 cDNA, complete cds
Pisum (pea) X85187 (Ps-EXP1) cDNA from flower petals
Lycopersicum (tomato)  U82123 Le-EXP1 cDNA from ripening fruit
AF096776 Le-EXP2 cDNA
AJ239068 Le-EXP2 gene for EXP2
AF059487 Le-EXP3 cDNA, complete cds
AF059488 Le-EXP4 cDNA, complete cds
AF059489 Le-EXP5 cDNA, complete cds
AF059490 Le-EXP6 partial (498 bp)
AF059491 Le-EXP7 partial (486 bp)
AF184232 Le-EXP8 unpublished;
AJ243340 Le-EXP9 cDNA, complete cds
AF184233 Le-EXP10 unpublished;
AF218775
AI781569
AI775584
AF218775
AI781569
AI775584
Le-EXP11 partial; ; contact Monika Werner
EST
EST
AJ004997
AJ270960
Le-EXP18 cDNA expressed in shoot meristem
partial cDNA from fruit
unpublished Le-EXP12 contact Hannes Vogler
 
Rumex acetosa   AF167365 Ra-EXP1 mRNA, partial cds
AF167357 Ra-EXP2 mRNA, partial cds
AF167358 Ra-EXP3 mRNA, partial cds
AF167359 Ra-EXP4 mRNA, partial cds
Rumex palustra - - -
AF167361 Rp-EXP2 partial cds
AF167362 Rp-EXP3 partial cds
AF167363 Rp-EXP4 partial cds
AF167364 Rp-EXP5 partial cds
AF167356 Rp-EXP6 partial cds
Brassica AJ000885 (Bn-EXP1) cDNA from young seedlings
Gossypium (cotton) AF043284, D88415 (Gh-EXP1) cDNAs from cotton fibers (ovule trichomes)
Fragaria x ananassa     (strawberry)
AF163812
Fa-EXP1  mRNA, partial cds; sequence update expected ~22 Jan 2000
AF159563 Fa-EXP2 mRNA, complete cds; 

AF226700 

Fa-EXP3 partial cds

AF226701

Fa-EXP4 partial cds

AF226702

Fa-EXP5 partial cds

AF226703

Fa-EXP6 partial cds

AF226704

Fa-EXP7 partial cds
Pinus  taeda (pine) U65891-5 - PCR cDNAs from hypocotyls
AC556861 - EST from Pinus taeda xylem
AF085330 - expansin cDNA, complete cds
Nicotiana (tobacco) AF049350 Nt-EXP1 cDNAs from BY2 cell culture
AF049351 Nt-EXP2 cDNAs from BY2 cell culture
AF049352 Nt-EXP3 cDNAs from BY2 cell culture
AF049353 Nt-EXP4 cDNAs from BY2 cell culture
AF049354 Nt-EXP5 cDNAs from BY2 cell culture
AF049355 Nt-EXP6 cDNAs from BY2 cell culture
Prunus armeniaca (apricot) U93167 Pa-EXP1 cDNA from fruit
AF038815 Pa-EXP2 cDNA from fruit
Marsilea quadrifolia (a fern)
AF202119 Mq-EXP1 complete cDNA from rachis
Regnellidium diphyllum (a fern) AF202120 Rd-EXP1 complete cDNA from rachis
Striga asiatica
(a parasitic plant)
AF291657 Exp1 partial cDNA
AF291658 Exp2 partial cDNA
AF291659 Exp3 complete cDNA
Zea  mays (maize) AAK56119
Zm-EXPA1
complete cDNA
AAK56120
Zm-EXPA2
complete cDNA
AAK56121
Zm-EXPA3
complete cDNA
AAK56122
Zm-EXPA4
partial cDNA
AAK56123
Zm-EXPA5
complete cDNA

 

Table 4: Some EXPB (b-expansin) sequences:

Plant Genus GenBank Name Comments
Glycine (soybean) U03860
CIM1
cytokinin induced mRNA
Cynodon (Bermuda grass) S83343
Cyn d1
pollen allergen
Phleum (timothy grass) X78813
Phl p1
pollen allergen
Lolium (rye grass) M57476
Lol p1
pollen allergen
Zea mays (maize) AF332174
Zm-EXPB1
Zea m1
pollen allergen; see Li et al. 2003 Plant Physiology 132:2073-2085
AF332175
Zm-EXPB2
partial cDNA
AF332176
Zm-EXPB3
partial cDNA
AF332177
Zm-EXPB4
complete cDNA
AF332178
Zm-EXPB5
partial cDNA
AF332179
Zm-EXPB6
complete cDNA
AF332180
Zm-EXPB7
complete cDNA
AF332181
Zm-EXPB8
complete cDNA
AY197352 Zm-EXPB9, Zea m1 pollen allergen; see Li et al. 2003 Plant Physiology 132:2073-2085
AY104999 Zm-EXPB10, Zea m1 pollen allergen; see Li et al. 2003 Plant Physiology 132:2073-2085
AY104125 Zm-EXPB11, Zea m1 pollen allergen; see Li et al. 2003 Plant Physiology 132:2073-2085
Holcus (velvet grass) Z27084
Hol-l1
pollen allergen
Oryza (rice) U31771
Ory s1
pollen allergen
Phalaris (canary grass) Q41260
Pha a1
pollen allergen
Poa pretense (timothy grass) AJ131850
Poa p1
pollen allergen
Tricicum aestivum (wheat) U91981
-
cDNA from roots
- -
-
-
 

This page was last updated on 03/22/06.

Send Comments to mailto:dcosgrove@psu.edu